SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006613 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006613
Domain Number 1 Region: 1-283,384-421
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.06e-42
Family FAD-linked reductases, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 263-369
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.36e-27
Family L-aminoacid/polyamine oxidase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006613   Gene: ENSNLEG00000005468   Transcript: ENSNLET00000006945
Sequence length 463
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:1834493:1841231:-1 gene:ENSNLEG00000005468 transcript:ENSNLET00000006945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTNFTQYDK
NTWTLVHEVKLRNYVVEKVPEKLGYALHPQEKGHSPEDIYQMALNQALKDLKALGCRKAM
KKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFYLSFAEALRAHSCLSDRLQYRRIV
GGWDLPRALMSSLSGKMLWNATFVAMTQGPHDVHVIETSPPARNLKVEKADLVLLTASGP
AVKRITFWPPLPRHMQEALRRLHYVPATKVFISFRRPFWREEPIEGGHSNTDRPSCMIFY
PTPREGALMLASYTWSDAAAAFAGLSREEALNLALDDVAALHGPVVRQLWDGTGVVKRWA
EDPHSQGGFVVQPPALWQTEKDYWTVPYGRIYFAGEHTAYPHGWVETAVKSALRAAIKIN
SRKGPASDTASPEGHASDMEGQGHVHGVAGSPSHDLAKEEGSY
Download sequence
Identical sequences ENSNLEP00000006613 ENSNLEP00000006613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]