SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006617 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006617
Domain Number 1 Region: 11-158
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-36
Family C-type lectin domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006617   Gene: ENSNLEG00000005464   Transcript: ENSNLET00000006949
Sequence length 158
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:15270269:15289927:-1 gene:ENSNLEG00000005464 transcript:ENSNLET00000006949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLTSILSLKEASTIAEYIGGYQRSQPVWIGLHDPQKRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Download sequence
Identical sequences G1R096
ENSNLEP00000006617 ENSNLEP00000006617 XP_003268113.1.23891 XP_003268114.1.23891 XP_012355779.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]