SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006638 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006638
Domain Number 1 Region: 132-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000153
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 30-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000585
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 211-275
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000705
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006638   Gene: ENSNLEG00000005486   Transcript: ENSNLET00000006971
Sequence length 297
Comment pep:novel supercontig:Nleu1.0:GL397326.1:1914444:1915964:1 gene:ENSNLEG00000005486 transcript:ENSNLET00000006971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VANAPRDLIISISRDNTSALELQGNVIYLEVQKGQFLWLLCAADSQPPAMLSWVLQDRVL
SSSHPWGPRTLGLELPGVKAGDSGRYICRAENRLGSQQRALDLSVQYPPENLRVMVSQAN
RTVLENLGNGISLPVLEGQSLRLVCVTHSSPLARLSWTRGGQTVGPSQPSDPGVLELPRV
EVEHEGEFTCHAWHPLGYQHVSLSLSVHCEPSPQLLGPSCSWEAEGLHCRCSSQASPVPS
LSWWLEEELLEGNSSQDSFKVTPSSAGLWANGSLTLGGLGSNLRLTFKAQNVHGAQS
Download sequence
Identical sequences ENSNLEP00000006638 ENSNLEP00000006638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]