SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006645 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006645
Domain Number 1 Region: 1809-2055
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 901-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000182
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 3 Region: 584-715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 402-526
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 773-905
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 1139-1258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 1003-1143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 747-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000547
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 938-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 10 Region: 281-450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 522-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 12 Region: 250-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000155
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 136-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000206
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 172-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 15 Region: 55-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 16 Region: 212-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000675
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 17 Region: 1254-1298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000796
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 18 Region: 1295-1334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000875
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1414-1446
Classification Level Classification E-value
Superfamily Notch domain 0.000000101
Family Notch domain 0.0015
Further Details:      
 
Domain Number 20 Region: 1366-1405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000125
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 21 Region: 706-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.015
Further Details:      
 
Domain Number 22 Region: 98-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 23 Region: 1493-1524
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006645
Domain Number - Region: 17-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 977-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.0073
Further Details:      
 
Domain Number - Region: 1456-1487
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006645   Gene: ENSNLEG00000005474   Transcript: ENSNLET00000006978
Sequence length 2460
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:15371462:15538551:-1 gene:ENSNLEG00000005474 transcript:ENSNLET00000006978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLIVLPMCISEPTHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEK
NRCQNGGTCVAQAMLGKATCRCASGFTGENCQYSTSHPCFVSRPCLNGGTCHMLSRDTYE
CTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPG
HCQHGGTCLNLPGSYQCQCPQGFTGQYCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLP
GFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQ
NGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAG
LLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHA
GKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVH
CELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDH
PNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDE
CYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVC
SPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCI
HGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGY
NCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKE
SSNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEE
DIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNS
YTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECS
SHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCP
SGWAGAYCDVPNVSCDIAASSRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQL
DECASNPCQHGATCSDFIGGYRCECIPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFK
CSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCHCLPGFAGERCEGDINECLS
NPCNSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFI
CRCPPGFSGARCQSSCGQVKCKKGEQCVHTASGPRCFCPSPQDCESGCASSPCQHGGSCH
PQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQW
DGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNSKTCKYDKYCA
DHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALG
TLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAGSKVFLEIDNR
QCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLYLLAVAVVIIL
FIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLI
GSGTSEHWVDDEGPQPKKVKVRRALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQ
AEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQA
QTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIR
NRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVE
ATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVAR
DRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLNLKHTPMGKKSRRPSAKST
MPTSLPNLAKEAKDAKGSRRKKSVSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMIT
SPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIV
SPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEG
KHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSV
AFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGE
HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHNNMQVYA
Download sequence
Identical sequences ENSNLEP00000006645 ENSNLEP00000006645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]