SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006669 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006669
Domain Number 1 Region: 326-601
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.19e-78
Family Mitochondrial carrier 0.000038
Further Details:      
 
Domain Number 2 Region: 10-192
Classification Level Classification E-value
Superfamily EF-hand 2.04e-22
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 3 Region: 154-289
Classification Level Classification E-value
Superfamily EF-hand 0.00000000253
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006669   Gene: ENSNLEG00000005482   Transcript: ENSNLET00000007003
Sequence length 678
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:15522292:15635434:-1 gene:ENSNLEG00000005482 transcript:ENSNLET00000007003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLL
AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII
HHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
DFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLA
GTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL
PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGS
GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR
DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGL
YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPAD
VIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL
LQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF
KSSSVAVVQPKAAVAATQ
Download sequence
Identical sequences A0A2I3H8N2
ENSNLEP00000006669 XP_003253753.1.23891 ENSNLEP00000006669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]