SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006723 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006723
Domain Number 1 Region: 156-241
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000667
Family RING finger domain, C3HC4 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006723   Gene: ENSNLEG00000005554   Transcript: ENSNLET00000007061
Sequence length 247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:39321374:39616399:1 gene:ENSNLEG00000005554 transcript:ENSNLET00000007061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRSSSNSGSTGFISFSGVESALSSLKSFQACINSGMDTASSVALDLVESRTEVSSEYS
MDKAMVEFATMDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQNKNSDADF
QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPV
KNKVCGHTYEEDAIVRMIESRHKRKKKACCPQIGCSHTDIRKSDLIQDEALRRAIENHNK
KRYRHSE
Download sequence
Identical sequences G1R0K2
XP_003256244.1.23891 XP_012363692.1.23891 ENSNLEP00000006723 ENSNLEP00000006723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]