SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006775 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006775
Domain Number 1 Region: 497-864
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.06e-125
Family Hect, E3 ligase catalytic domain 0.0000000000113
Further Details:      
 
Domain Number 2 Region: 400-440
Classification Level Classification E-value
Superfamily WW domain 8.9e-16
Family WW domain 0.00051
Further Details:      
 
Domain Number 3 Region: 18-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000818
Family PLC-like (P variant) 0.0016
Further Details:      
 
Domain Number 4 Region: 332-365
Classification Level Classification E-value
Superfamily WW domain 0.00000000000205
Family WW domain 0.0013
Further Details:      
 
Domain Number 5 Region: 297-332
Classification Level Classification E-value
Superfamily WW domain 0.00000000000529
Family WW domain 0.0015
Further Details:      
 
Domain Number 6 Region: 442-477
Classification Level Classification E-value
Superfamily WW domain 0.0000000000148
Family WW domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006775   Gene: ENSNLEG00000005599   Transcript: ENSNLET00000007115
Sequence length 870
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:22554668:22704455:1 gene:ENSNLEG00000005599 transcript:ENSNLET00000007115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRI
GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENTQLT
LNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSAVTDGSQLPSRDSSGTAVAPENRHQ
PPSTNCFGGRSRTHRHSGASARTAPATGEQSPGARSRHRQPVKNSGHSGLANGHRLNDEP
TTATDPEEPSIVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAP
DALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQ
RPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGR
VYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGF
ESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYD
LRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINP
DHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIK
ENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEE
QTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWF
WQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGTGKPSLFSPSLLGLTVMLPRSNSFN
RLDLPPYKSYEQLREKLLYAIEETEGFGQE
Download sequence
Identical sequences ENSNLEP00000006775 ENSNLEP00000006775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]