SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006802 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006802
Domain Number 1 Region: 31-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000341
Family V set domains (antibody variable domain-like) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006802   Gene: ENSNLEG00000005622   Transcript: ENSNLET00000007143
Sequence length 181
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:16283288:16293734:1 gene:ENSNLEG00000005622 transcript:ENSNLET00000007143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL
CKDRSGDCSPETSLKQLRLKRDPGIDGVGEVSSQLMFTISQVTPSHSGTYQCCARSQKSG
IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSDFLQEKVWVMLVTSLVALQA
L
Download sequence
Identical sequences G1R0T1
ENSNLEP00000006802 XP_003268138.1.23891 ENSNLEP00000006802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]