SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006814 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006814
Domain Number 1 Region: 24-466
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.26e-73
Family Integrin alpha N-terminal domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 794-1018
Classification Level Classification E-value
Superfamily Integrin domains 2.98e-55
Family Integrin domains 0.00052
Further Details:      
 
Domain Number 3 Region: 466-628
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-33
Family Integrin domains 0.00082
Further Details:      
 
Domain Number 4 Region: 629-791
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-27
Family Integrin domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006814   Gene: ENSNLEG00000005561   Transcript: ENSNLET00000007155
Sequence length 1073
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:16188586:16273465:1 gene:ENSNLEG00000005561 transcript:ENSNLET00000007155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGQLCLLYLSAGLLPRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAGALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETQHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSTH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGTSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLHPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
IPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQNEINILNLKESHKSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILMRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRNKKDHYDATYHKAEIHAQPSDKERLTSDA
Download sequence
Identical sequences G1R0U3
XP_003253761.1.23891 ENSNLEP00000006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]