SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006832 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006832
Domain Number 1 Region: 57-328
Classification Level Classification E-value
Superfamily L domain-like 4e-58
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 362-455
Classification Level Classification E-value
Superfamily Immunoglobulin 7.03e-20
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006832   Gene: ENSNLEG00000005646   Transcript: ENSNLET00000007174
Sequence length 645
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:2254581:2444519:-1 gene:ENSNLEG00000005646 transcript:ENSNLET00000007174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARGSPCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVA
CSCSNQASRVICTRRDLAEVPASIPVNTRYLNLQENGIQVIRTDTVKHLRHLEILQLSKN
LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGTGGGGGGPGGSGGVGGG
SGGYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTA
PAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLR
KQHQLHKHHGPTRTVEIINVEDALQVTATVTVTAAAAVSESSSSG
Download sequence
Identical sequences ENSNLEP00000006832 ENSNLEP00000006832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]