SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006840 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006840
Domain Number 1 Region: 20-132
Classification Level Classification E-value
Superfamily Immunoglobulin 3.17e-16
Family V set domains (antibody variable domain-like) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006840   Gene: ENSNLEG00000005647   Transcript: ENSNLET00000007182
Sequence length 332
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:12129497:12148605:-1 gene:ENSNLEG00000005647 transcript:ENSNLET00000007182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLVLLWGCLLLPGYEALEGPKEISGFEGDTVSLQCIYREELRDHRKYWCRKGGILFAR
CSGTIYAGEEGQETTEGRVSIRDSRQELSLIVTLWNLTLQDAGKYWCGVEKRGPDESLLI
SLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQAQPPGLTSPGLYPAITTAKQGKTGAE
ATPFSGTSQYGHERTSQYTGTSPQAATSPPAGSSRPPMQLDSTSAEDASPALSSGSSKPR
VSIPTVRILAPVLVLLSLLSAAGLIAFGSHLLLWRKEAQQATETQRNEKVCLSHLTTEEK
EAPSQAPEGDVISMPPLHTSEEELGFSKFVSV
Download sequence
Identical sequences A0A2I3GSN7
ENSNLEP00000006840 ENSNLEP00000006840 XP_003270812.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]