SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006856 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006856
Domain Number 1 Region: 342-406
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.41e-18
Family TB module/8-cys domain 0.00046
Further Details:      
 
Domain Number 2 Region: 854-908
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-16
Family TB module/8-cys domain 0.00017
Further Details:      
 
Domain Number 3 Region: 620-729
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 519-646
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000738
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 1021-1072
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000144
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 6 Region: 217-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000419
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 7 Region: 292-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000291
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 8 Region: 806-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 1109-1150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000574
Family EGF-type module 0.007
Further Details:      
 
Domain Number 10 Region: 1136-1186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 945-977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000331
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 109-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006856   Gene: ENSNLEG00000005644   Transcript: ENSNLET00000007198
Sequence length 1191
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:4498957:4519210:-1 gene:ENSNLEG00000005644 transcript:ENSNLET00000007198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLGLGSRVEGGPAGERGAGGGGALARERFKV
VFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGGQCS
SRNQCLCPPDFTGRFCQVPAGGASGGTGGSGPGLSRAGALSTGALPPLAPEGDSVASKHA
IYAVQVHRIESSNAEGAAPSQHLLPHPKPSHPRPPTQKPLGRCFQDTLPKQPCGSNPLPG
LTKQEDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDI
NECAMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKSEEKSLCFRLVSPEHQCQ
HPLTTRLTRQLCCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYHILTSHQTLTIQGES
DFSLFLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEQRSVQQSHPTATTSPA
RPYPELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPD
YSCHCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGR
SCVDLNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDG
KCENKPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAP
APDGRSCLDTAGWEEGGLGETGVGCWGTPGVMACACMRFHLQKKKKKKFIEHLLFSRFCA
LGGEELGSGGWSRVRQELGFQLRYSCPPDIDECSQDPGLCLPHGACKNLQGSYVCVCDEG
FTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIY
PCPVYSSGQEPGRPLPRSSVSSSGSQMWEMAPPGTLSPRARSDPAACRPGRCVNLPGSYR
CECRPPWVPGPSGRDCQLPESPAGEGEGRPWPTPGPCPSRGRSLPWALPRCQVPSAERAP
ERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSQCPTSQSE
SNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARC
VDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences ENSNLEP00000006856 ENSNLEP00000006856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]