SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006863 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006863
Domain Number 1 Region: 559-814
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-82
Family Eukaryotic proteases 0.0000986
Further Details:      
 
Domain Number 2 Region: 42-294
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-72
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 3 Region: 429-530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 854-944
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000107
Family Spermadhesin, CUB domain 0.0079
Further Details:      
 
Domain Number 5 Region: 333-410
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000536
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 
Domain Number 6 Region: 1000-1053
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000916
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006863   Gene: ENSNLEG00000005656   Transcript: ENSNLET00000007205
Sequence length 1054
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:20859938:20919598:-1 gene:ENSNLEG00000005656 transcript:ENSNLET00000007205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLASAGLLLLLVIGHPRSLGLKCGIRMVNMKSKEPAVGSRFFSRRSSWRNSTVTGHPW
QVSLKSDEHHFCGGSLIQEDRVVTAAHCLHHLNEKQLKNITVTSGEYSLFQKDKQEQNIP
VTKIITHPEYNSREYMSPDIALLYLKHKVKFGSAVQPICLPDSDDKVEPGILCLSSGWGK
ISKTSEYSNVLQEMELPIMDDRTCNTVLKSMNLPPLGRTMLCAGFPDGGMDTCQGDSGGP
LVCRRGGGIWILAGITSWVAGCAGGSASVRNNHMKASLGIFSKVSELMAFITQNLFTGLD
RGQPLSKVGPRYVTKALSSVQEVNGSQRGEGILDMEKQVGCDHDYVSLQSSNGVLINQRS
LMEDDGKQKRKVCGKILPSPLLAETSEAMVPFVSGTEDSGGGFELTFTAVQNSEAGSGCG
SLAILVEEGTNHSAKYPDLYPSNVRCHWFIPAPEKHIIKLTFEDFAVKFRPNCIYDAVVI
YGDSEEEHKLAKLCGMLTITSIFSSSNMMVIHFKNDGRNRLQGFEARFTILPSESVNKFE
PKLPPQNNPVSTVKAIPHDVCGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYEC
GGAIINPMWILTAAHCVQPKNNPLSWTVIAGDHDRNLKESTEQVRRAKHIIVHEDFNTLS
YDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEICAVTGWGSISADGGPASRLQQIQ
VHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCRRENGPFVLHG
IVSWGAGCVQQWKPGMGIFARVMIFLDWIQSKINGPASLQTNNKRKTLKQQWPPPTPSPD
SASWPGCCSEAELEKPRGFFPTPPYPPDYRGRLECSWVLRVSPSIMAKFTIESLLGSPVC
QDSVLIIYEERHSKRKMAGGLHGRRLYSMTFMSPGPLVRVTFHALVQDAFGISYIVLKVL
GPKGSKITRLSQSSNREHLVPCEDVLLTKPEGITQIPRNSHKTTMGCQWKLVAPLNHIIQ
LHIINFPMKPTTSVCHGHLRVYEGFGPGKKLIGN
Download sequence
Identical sequences ENSNLEP00000006863 ENSNLEP00000006863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]