SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006898 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006898
Domain Number 1 Region: 93-360
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.2e-57
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 47-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000119
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006898   Gene: ENSNLEG00000005694   Transcript: ENSNLET00000007241
Sequence length 361
Comment pep:novel supercontig:Nleu1.0:GL397289.1:25083352:25088099:-1 gene:ENSNLEG00000005694 transcript:ENSNLET00000007241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSTALPEARPTKMRALGAVIALLLWGQLFAVDSGNDVTDIAGDGCPKPPEIAHGYVEH
SVRYQCKNYYRLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANVVQRLLGG
HLDANGSFPWQAKMVSRHNLTTGATLISEQWLLTTAKNLFLNHSENATAKDIAPTLTLYV
GKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVPVNERVMPICLPSKDYAEVGRVGYVSGWG
RNANFKFTDHLKYVMLPVADQDQCVRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSK
YQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAE
N
Download sequence
Identical sequences ENSNLEP00000006898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]