SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006906 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006906
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-23
Family C1 set domains (antibody constant domain-like) 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006906   Gene: ENSNLEG00000005686   Transcript: ENSNLET00000007249
Sequence length 119
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:5656911:5667205:1 gene:ENSNLEG00000005686 transcript:ENSNLET00000007249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGKKIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKTVKWDRDM
Download sequence
Identical sequences A0A2I3H2C7
ENSNLEP00000006906 ENSNLEP00000006906 XP_003266898.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]