SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006908 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006908
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-46
Family Dual specificity phosphatase-like 0.0000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006908   Gene: ENSNLEG00000005702   Transcript: ENSNLET00000007251
Sequence length 185
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:12217864:12231518:1 gene:ENSNLEG00000005702 transcript:ENSNLET00000007251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKIGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Download sequence
Identical sequences G1R137
ENSNLEP00000006908 ENSNLEP00000006908 XP_003270819.1.23891 XP_012353160.1.23891 XP_012353161.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]