SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006922 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006922
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-23
Family Caspase recruitment domain, CARD 0.00000659
Further Details:      
 
Domain Number 2 Region: 110-191
Classification Level Classification E-value
Superfamily DEATH domain 5e-20
Family DEATH domain, DD 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006922   Gene: ENSNLEG00000005714   Transcript: ENSNLET00000007265
Sequence length 199
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:29313819:29490033:1 gene:ENSNLEG00000005714 transcript:ENSNLET00000007265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEINAQTTGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLKKAREEVMTDLPAGDRLTGIPLHILNSSPSDRQI
NQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQVVEALVRWRQRFGKQATFQSL
HNGLQAVEVDPSLLLHMLE
Download sequence
Identical sequences A0A2I3H981
ENSNLEP00000006922 ENSNLEP00000006922 ENSNLEP00000024416 XP_003259716.1.23891 XP_003259717.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]