SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006935 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006935
Domain Number 1 Region: 745-849
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.08e-28
Family Lipoxigenase N-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 31-138
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000326
Family C-type lectin domain 0.015
Further Details:      
 
Domain Number 3 Region: 1467-1520,1558-1666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000863
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006935   Gene: ENSNLEG00000005720   Transcript: ENSNLET00000007279
Sequence length 1734
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:25150398:25233485:1 gene:ENSNLEG00000005720 transcript:ENSNLET00000007279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFKGGSWLWLYIRTSIILGSELNRPAPHGQNNCYQLNRFHCSFEEAEHYCHVQRGFLAH
IWNKEVQDLIQAYLEEGKKWWIGQNVMPLKKHQDNKYPADVAAHGPPKPPSCTYLSRNFH
QISSKGDECLLRYYFICQTGDFLDGDAHYERNGNNSHLYQRHKKTKRGVAIARDKMPPAP
GHVPTTCHYPLPAHLSKTLCHPISPFPSVLPSITSQVTSATSEPSSQPLPVITQLTTPVS
VTHAGQSLAETTASPKEEAHPNTFTSYLQMSLQNTSGQVIDEIGNFSRADHGLQKAHNKL
QEACEFLQKLRVLTPRFSKPVQVNLINSLIYLSEELLRIPFENNNSLSFKVPATVCPFHS
FNDATKAGERSWLESKSDTEQVEDILEMSLVEFGNIGEAFLEQNQSPESSVTLTSSIATL
LLSRQNISTLPLSSYTLGHPAPVRLGFPSVSALKKLLNKHPGVTVQITGLAFNPFKDLDN
RNIVGSIGSVLLSANRKLLQVHDLMEDIEIMLWRNVSVETHPTSLNMSTHQLTITVNITS
LEKSLIVSIDPDTPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLTPEHLE
HGIGTYYITAVLSERQEGAQQTPSLVSVITAVTQCYYWEIHNQTWSSTGCQVGPQSTILR
TQCLCNHLTFFASDFFVVPRTVNVEDTIELFLRVTNNPVGVSLLASLLGFYVITVVWAWK
KDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRRAATTAKVVITLYGSEGRSEPHHLC
DPQKTVFERGGLDVFLLTTWSSLGDLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHF
LCNCWLAVDLGDCELDRVFIPVSKKELFSFRHLFSSMIVEKFTQDYLWLSVATRHPWNQF
TRVQRLSCCMTLLLCNMVINVMFWKINSTTAKRDEQMGPFAVAWSELLISIHTAVILFPI
NLVIGRLFPLIEPQETLPLFPPVQASCLSDASVEPLSATMVVEELKETVRFLLRRNTYLL
SKSETAPLHSSLGNIVRLWWLTPVISALWEAKACRSPEVRISWAHTIVPENHHHFCCYLR
RVLQRLKSHLGTLGLTQGHQSCDFLDAASQLQKLQELLETHILPMQQEPSREVTSFAILS
SEEGKKPISNALSKWLTSVCWLLLGLTSLASAFFTALYSLELSKDQATSWMTSIILSVLQ
NVFIGQPVKVVFLTFLYSLMMSRMPRLNKEKEQQTKRILALLAKCSSSVPGSRDKNNPIY
VAPAMNSPTKRPERTLKNKKLFKLTGDILVQILFLTLLMTAIYSAKNSNRFYLHQALQKT
FSHQFSEIKLLQDFYPWANHILLPSLYGDYRGKNAVLEPSHCKCGVQLIFQIPHTKTYEK
VEEGQLAFSDGHTCGHPKSLFSGLHLRRFSYICSPRPMALIPTDELHKRLTSKNENGFSY
IMRSAFFTSVRLETFTSLQMSKKGFAWSIISQVIYYLLVCYYAFIQVCRLKRQKWRFFTG
KRNILDTSIILISFIILGLDMKSISLQKKNMARYRDDQDRFISFYEAVKANSAATHLVGF
LVLLATVQLWNLLRHSPRLRVISRTLSQAWDEVVGFLLIILILLTGYAIAFNLLFGCSIS
DYQTFFSSAVTVVGFLMGISHQEEVFALDPVLGTFLILTSVTLMVLVVINLFISAILMAF
GKERKSLKKEAALIDTLLQKLSNLLAISQPQKTSSEQAAVTAMGSDTEVLDELP
Download sequence
Identical sequences ENSNLEP00000006935 ENSNLEP00000006935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]