SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006956 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006956
Domain Number 1 Region: 175-319
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-25
Family C-type lectin domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006956   Gene: ENSNLEG00000005739   Transcript: ENSNLET00000007300
Sequence length 320
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:2593930:2596405:1 gene:ENSNLEG00000005739 transcript:ENSNLET00000007300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEPDCLLGG
DENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGL
HQLHVRLHALDTRVVELTQGLRQLRNAASDTRDAVQALQETQGRAEREHGRLEGCLKGLH
LGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTGYLRAALAPYNWPVWLGV
HDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQSDD
GSWWDHDCQRRLYYVCEFPF
Download sequence
Identical sequences ENSNLEP00000006956 ENSNLEP00000006956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]