SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007050 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007050
Domain Number 1 Region: 51-118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007050   Gene: ENSNLEG00000005824   Transcript: ENSNLET00000007400
Sequence length 279
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:47545197:47586941:1 gene:ENSNLEG00000005824 transcript:ENSNLET00000007400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWFLPWTLAAVTAAAASSVLAMALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCARAPR
PLGLTRRLCLQRWSVWAASWTGCATATASPSSLTASTTARASTARWAAHHCASDSFPFLQ
AGKKCLVVYHPEASMNFTLAGCVSTRSYQPKYCGVCMDNRCCIPYKSKTINVSFQCPDGL
GFSRQVLWINACFCNLNCRNPNDIFADLESYPDFSEISN
Download sequence
Identical sequences ENSNLEP00000007050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]