SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007061 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007061
Domain Number 1 Region: 484-610
Classification Level Classification E-value
Superfamily TIMP-like 2.75e-28
Family Netrin-like domain (NTR/C345C module) 0.078
Further Details:      
 
Domain Number 2 Region: 314-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000837
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 3 Region: 244-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000009
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 4 Region: 377-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007061
Domain Number - Region: 83-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0272
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007061   Gene: ENSNLEG00000005820   Transcript: ENSNLET00000007410
Sequence length 610
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:31367926:31506307:-1 gene:ENSNLEG00000005820 transcript:ENSNLET00000007410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCRQPKCD
KCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIMMFKSPR
PAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIF
KALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIV
KGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEA
ADGKTAAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQHCQRCKPGF
YRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRHCDRCMVGY
WGFGDYGCRPCDCAGSCDPISGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFS
ALLHSGKCECKEQILGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLK
IFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDVRTGKLIVNMKSFVQRWKPSLGRK
VMDILKRECK
Download sequence
Identical sequences ENSNLEP00000007061 ENSNLEP00000007061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]