SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007078 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007078
Domain Number 1 Region: 135-224
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000936
Family Fibronectin type III 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007078
Domain Number - Region: 4-61
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0759
Family Apolipoprotein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007078   Gene: ENSNLEG00000005850   Transcript: ENSNLET00000007430
Sequence length 376
Comment pep:known_by_projection supercontig:Nleu1.0:GL397459.1:20097:63993:-1 gene:ENSNLEG00000005850 transcript:ENSNLET00000007430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKESASQTRDVLKQHFNDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEHG
VNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDS
ILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNH
FEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFE
GYSLSSRRNIALRNDSESSGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDG
YDSLQRDQAVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGLSLCM
SNQLIRCVFAGPSGGS
Download sequence
Identical sequences ENSNLEP00000007078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]