SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007080 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007080
Domain Number 1 Region: 29-145
Classification Level Classification E-value
Superfamily Immunoglobulin 7.84e-23
Family V set domains (antibody variable domain-like) 0.00000147
Further Details:      
 
Domain Number 2 Region: 148-234
Classification Level Classification E-value
Superfamily Immunoglobulin 3.3e-18
Family C2 set domains 0.07
Further Details:      
 
Domain Number 3 Region: 262-335
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000939
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007080   Gene: ENSNLEG00000005846   Transcript: ENSNLET00000007432
Sequence length 468
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:2968934:2980147:1 gene:ENSNLEG00000005846 transcript:ENSNLET00000007432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLPLLWGRERVEGQKSNQKNYPLMMQSSVTVQEGLCVHVRCSFSYPVDSQTDSD
PVHGYWFRAGDDISWKTPVATNNRARAVREETRDRFHLLGDPQTKNCTLSIRDARMSDAG
TYFYRMERGKIKWNYKYHQLSVHVTALTHRPNIVIPGTLESGCFQNLTCSVPWACEQGTP
PMISWMGTSLSPLHPSTTRSSVLTLIPQPQDHGTSLTCQVTLPGAGVTTNRTIRLNVSYP
PQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQ
PSNPLVLELRVHLGDEGEFTCRARNSLGSQHFSLNLSLQHEYTGKMRPVSGVTLGAVGGA
GATALVFLSFCVIFIVVRSYRKKSARPAAGVGDTGMEDANAIRGSASQGTMIESWADDNP
RHHGLAAPSSGEEGEIQYASVSFHKVEPQDLSGQEATNNEYSEIKIPK
Download sequence
Identical sequences G1R1K8
ENSNLEP00000007080 ENSNLEP00000007080 XP_003269883.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]