SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007087 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007087
Domain Number 1 Region: 19-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-22
Family V set domains (antibody variable domain-like) 0.0000296
Further Details:      
 
Domain Number 2 Region: 143-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-17
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007087   Gene: ENSNLEG00000005856   Transcript: ENSNLET00000007439
Sequence length 364
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3030152:3043975:1 gene:ENSNLEG00000005856 transcript:ENSNLET00000007439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLPLLWAGALAMDPKIWLQVQESVTVQEGLCVLVPCTFSHPIPHYDRNSPVHGYW
FREGAIVSWDSPVATNKLDQEVQQETQGRFHLLGDLSRNNCSLSIMDARRRDNGSYFFRM
ERGRTKYSYKSPQLSVHVTDLTNRPKILIPGALDPGHSKNLTCSVPWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITARPQDHGTNLTCQVKFPGAGVTTERTIQLNVTYAPQNPTT
GIFLGDGSGKQETRAGVVHGAIGGAGITALLALCLCLIFFIVKTHRKKAARTAVGRNDTH
PATGPASPKHQKKSKLHGPTETSSCSGAAPTVEIDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ
Download sequence
Identical sequences G1R1L5
XP_012365318.1.23891 ENSNLEP00000007087 ENSNLEP00000007087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]