SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007094 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007094
Domain Number 1 Region: 18-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000256
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007094   Gene: ENSNLEG00000005863   Transcript: ENSNLET00000007446
Sequence length 194
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3071631:3076587:1 gene:ENSNLEG00000005863 transcript:ENSNLET00000007446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLQLVPAKLVNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST
MLGPWANSTISLTEEPEMGMRLLCEGKNQNGTHALSILLMSRKSSVASQAFVKGLIQGAI
YAGIVIVLLFLCLLPLIVKHIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVV
ATFSESRILEKQDK
Download sequence
Identical sequences ENSNLEP00000007094 XP_003269889.3.23891 ENSNLEP00000007094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]