SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007101 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007101
Domain Number 1 Region: 200-293
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 118-208
Classification Level Classification E-value
Superfamily Immunoglobulin 4.81e-16
Family I set domains 0.048
Further Details:      
 
Domain Number 3 Region: 24-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000356
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007101   Gene: ENSNLEG00000005867   Transcript: ENSNLET00000007453
Sequence length 323
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3132723:3141511:1 gene:ENSNLEG00000005867 transcript:ENSNLET00000007453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LATAKAEPSPPSTGLLSQSVEFNSLADNYTVCEGDNATLSCFIDEHVTRVAWLNRSNILY
AGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPA
RIVNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEY
ECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTARGRAALLRCEAMAVPPADFQWYKD
DRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLE
NSAPRPPGPLALLSTLGWLWWRM
Download sequence
Identical sequences ENSNLEP00000007101 ENSNLEP00000007101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]