SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007116 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007116
Domain Number 1 Region: 415-519
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000769
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 302-404
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000349
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 199-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000908
Family I set domains 0.082
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007116
Domain Number - Region: 577-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000132
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007116   Gene: ENSNLEG00000005872   Transcript: ENSNLET00000007469
Sequence length 881
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3141003:3153329:-1 gene:ENSNLEG00000005872 transcript:ENSNLET00000007469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPQALPLFLLLASLVGVLTLRASSGLRQTNFSSAFSSDSKSSSQGLGAEVPSIKPPSW
KVPDQSLDSKGSAGISDSSWFPEALSSNMSGSFWSNVSAEGQDLSLFSPFSETPGSEVFP
DISDPQVPAKDPKPSFTVKTPVSNISTQVSNTKLSVEAPDSKFSPDDMDLKLSAQSPESK
FSAETHSAASFPQQVGGPLAVLVGTTIRLPLVPVPNPGPPTSLVVWRRGSKVLAAGGLGP
GAPLISLDPAHRDRLRFDQARGVLELASAQLDDAGVYTAEVIRAGVSRQTREFTVGVYEP
LPQLSVQPKSPETEEGAAELRLRCLGWGPGRGELSWSRDGRALEEAESEGAQTPRIRSEG
DQLLIARPVRSDHARYTCRVRSPFGHREAAVDVTVFYGPDPPIITVSSDRDAAPVLFVTA
GSNVTLRCAAASRPPADITWSLADPAEAAVPAGSRLLLPAVGPGHAGTYACLAANPRTGR
RRRSLLNLTVADLPPGAPQCSVEGGPGDRSLRFRCSWPGGVPAASLQFQGLPEGIRAGPV
SSVLLAAVPAHPRLSGVPITCLARHLVATRTCTVTPEAPREVLLHPLVAETRLGEAEVAL
EASGCPPPSRASWAREGRPLAPGGGSRLWLSQDGRKLHIGNFSLDWDLGNYSVLCSGALG
AGGDQITLIGPSISSWRLQRARDAAVLTWDVERGALISSFEIQAWPDGPPLGRTSTYRDW
VSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVYRAGPTLSHGAIAGI
VLGSLLGLALLAVLLLLCICCLCRFRGKTPEKKKHPSTLVPVVTPSEKKMHSVTPVEISW
PLDLKVPLEDHSSTRVYQATDPSPVVSVGGGSKTVRAATQV
Download sequence
Identical sequences XP_003269891.2.23891 ENSNLEP00000007116 ENSNLEP00000007116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]