SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007130 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007130
Domain Number 1 Region: 493-578
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000238
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007130   Gene: ENSNLEG00000005893   Transcript: ENSNLET00000007484
Sequence length 580
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:31577562:31604387:-1 gene:ENSNLEG00000005893 transcript:ENSNLET00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALGRQATEPAPALRIDYPKALQIL
MEGGTHMVCTGRTHTDRICRFKWLCYSNEAEEFIFFHGNTSVMLPNLGSRRFQPALLDLS
TVEDHNTQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLR
QFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKIT
TWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLI
LNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLVTTLFLPRGAT
VVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRA
EQARILQSREVPRHLCCRNPEWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPWKQKWTVGL
YPGKVREARCQASVHGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILA
LQNHTFTENIKPFTTYLVWVRCIFNKILLGPFADVLVCST
Download sequence
Identical sequences G1R1Q8
XP_003256976.1.23891 ENSNLEP00000007130 ENSNLEP00000007130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]