SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007134 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007134
Domain Number 1 Region: 43-141,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.23e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007134   Gene: ENSNLEG00000005894   Transcript: ENSNLET00000007488
Sequence length 450
Comment pep:novel supercontig:Nleu1.0:GL397306.1:6599351:6638918:1 gene:ENSNLEG00000005894 transcript:ENSNLET00000007488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGADNVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTE
LNPDKNCIHTDNDEKVTTGAFGFFVNFLCTLLQIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIRERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMGP
PDVLKTSPVADAAGWVDVDKETLQHKRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences ENSNLEP00000007134 ENSNLEP00000007134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]