SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007155 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007155
Domain Number 1 Region: 162-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 33-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 278-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000597
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007155   Gene: ENSNLEG00000005884   Transcript: ENSNLET00000007510
Sequence length 443
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:4788460:4795080:-1 gene:ENSNLEG00000005884 transcript:ENSNLET00000007510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCASCLPGSLLLWALLLLLLGSASPQDSEESDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQES
CVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYIQVSDNRCLCPASNPLCREQPSSIVHRYMTITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences G1R1T3
ENSNLEP00000007155 XP_003274253.1.23891 ENSNLEP00000007155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]