SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007172 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007172
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily Immunoglobulin 1.74e-21
Family V set domains (antibody variable domain-like) 0.0000582
Further Details:      
 
Domain Number 2 Region: 148-233
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-16
Family I set domains 0.06
Further Details:      
 
Domain Number 3 Region: 262-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000097
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007172   Gene: ENSNLEG00000005929   Transcript: ENSNLET00000007528
Sequence length 492
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3279198:3288048:-1 gene:ENSNLEG00000005929 transcript:ENSNLET00000007528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVIWGTKRMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPRDGWTYSDPVHVYWF
RAGDRPNRDAPVATNNPDREVQEETQGRFQLLGDIWSNDCSLSIRDASKRDEGSYFFRLE
RGSMKWSYKSQLNDKVKQLSVFVTALTHRPDILILGTLESGHPRNLTCSVPWACKQGTPP
MISWIGTFMSSPGPTTARSSVLTLIPKPQDHGTSLACQVTLPGTGVTTTSTVRLNVSYPP
WNLTVTVFQGDATASTALGNGSSLSVPEGQSLRLVCAVNSNPPARLSWTRGSLTLCPSPS
SNPGLLELPRVHLGDEGEFTCRAQNPRGSQHISLSLSLQNEGTGTARLVSEVTLAAVGGA
GATALAFLSFCVIFIIVRSCRKKSARPAAGGGDTGMEDAKAIRGSASQGPLTESWKDGSP
PKKPPPAVAPSSGEEGELHYATLSFHKVKHQDPQGQEATDSEYSEIKIHKRETAETQACL
SNHNPSSKEVRG
Download sequence
Identical sequences ENSNLEP00000007172 ENSNLEP00000007172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]