SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007183 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007183
Domain Number 1 Region: 144-229
Classification Level Classification E-value
Superfamily Immunoglobulin 3.03e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 32-141
Classification Level Classification E-value
Superfamily Immunoglobulin 5.57e-16
Family V set domains (antibody variable domain-like) 0.00022
Further Details:      
 
Domain Number 3 Region: 258-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000671
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007183   Gene: ENSNLEG00000005932   Transcript: ENSNLET00000007540
Sequence length 452
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3330209:3342545:-1 gene:ENSNLEG00000005932 transcript:ENSNLET00000007540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTSSASY
PDYGYWFLEGADVPVATNDPHEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFF
RLKLKWTKYVYTSSKLSVRVMALTHRPNISIPGTLESGCSRTLTCSVPWACEQGTPPIFS
WMSAAPTSLGPRTTQSSVLTITPQPQDHSTNLTCQVTFPGASVTVERTIQLNVSYAPQKV
AVSIFQGNSTAFKILQNTSSLPVLEGQALRLLCDADSNPPAHLSWFQGFPALNATPISNT
GVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHRKPEGRAGGVLGAVWGAGITALVF
LCVCFIFRMKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDE
QELHYAFLRFHKVQLQEPKVTDTEYSEIKIHK
Download sequence
Identical sequences ENSNLEP00000007183 ENSNLEP00000007183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]