SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007192 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007192
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000111
Family V set domains (antibody variable domain-like) 0.0004
Further Details:      
 
Domain Number 2 Region: 101-188
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000647
Family C2 set domains 0.022
Further Details:      
 
Domain Number 3 Region: 215-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000294
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 294-384
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000383
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007192   Gene: ENSNLEG00000005946   Transcript: ENSNLET00000007549
Sequence length 510
Comment pep:novel supercontig:Nleu1.0:GL397326.1:3429846:3447016:-1 gene:ENSNLEG00000005946 transcript:ENSNLET00000007549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFSYPWSSWYSSPTLYIYWFRDGENPHYADAVATNHPDRRVKPETQGRFRLLGDVQKKNC
SLSIGDARMRDRGSYFFRVERGRDVKYSYQQNKLNLEVTALTEKPDIHFLEPLESGRHTR
LSCSLPGSCEAGRPLAFSWKGDALSPLDPETTCSSELTLTPRPEDHGTNLTCQVKRQGAQ
VTTERTVQLNVSYAPQTITIFRNGIALEILQNTSYLQVLEGQALQLLCDAPSNPPAHLSW
FQGSPALNTTPISNTGILELRRVGSAEEGGFTCRAQHPLGFRQIFLNLSVYSLPQLLGPS
CSSEAEGLHCSCSFRARPAPSLCWWLGEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGG
LSPGLKVSCKAWNVYGSQSGSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLI
VKARRKQAAGRPEKMDDEDPIMGTVSLGSRKKPWPDSPGDQASPAGDVPPLEEQKELYYA
SLSFSEMKPREPKDQEAPSTTEYSEIKTSK
Download sequence
Identical sequences ENSNLEP00000007192 ENSNLEP00000007192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]