SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007195 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007195
Domain Number 1 Region: 141-219
Classification Level Classification E-value
Superfamily Immunoglobulin 7.79e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 23-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000144
Family C2 set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007195   Gene: ENSNLEG00000005950   Transcript: ENSNLET00000007552
Sequence length 264
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:3463988:3466952:-1 gene:ENSNLEG00000005950 transcript:ENSNLET00000007552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERGRDVKYSYQQNKLSLEVTALTEKPDIHFLEPLESGRPTRLSCSLPGSCEAGRPLAFS
WKGDALSPLDPETTRSSELTLTPRPEDHGTNLTCQVKRQGAQVTTERTVQLNVSYAPQNL
AVSIFFRNGTGTALRILSNGMSVPILEGQSLFLACTVDSNPPASLSWFREGKALNPSQTS
VSGILELPNIGAREGGEFTCWVQHPLGSQHLSFILSVQKSSSSCICVTEKQQGSWPLVLT
LIRGALMGAGFLLTYSFTWIYYTR
Download sequence
Identical sequences ENSNLEP00000007195 ENSNLEP00000007195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]