SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007200 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000007200
Domain Number - Region: 10-52
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0879
Family I set domains 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007200   Gene: ENSNLEG00000005956   Transcript: ENSNLET00000007557
Sequence length 122
Comment pep:novel supercontig:Nleu1.0:GL397326.1:3524640:3526565:1 gene:ENSNLEG00000005956 transcript:ENSNLET00000007557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQAEGYLARIRPAQLTHRGTFSCVIKQDQRPLARLYFFLNVTGPPPRAETELQTSFREV
LRWAPRDAELIEPWRPSLGELLARPEALTPSNLFLLAALGALASASATVLAWMFFRWYCS
GN
Download sequence
Identical sequences ENSNLEP00000007200 ENSNLEP00000007200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]