SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007262 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007262
Domain Number 1 Region: 524-739
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-104
Family Thrombospondin C-terminal domain 0.0000000945
Further Details:      
 
Domain Number 2 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.48e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00012
Further Details:      
 
Domain Number 3 Region: 349-437
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000458
Family TSP type-3 repeat 0.000088
Further Details:      
 
Domain Number 4 Region: 268-350
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000123
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 120-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007262
Domain Number - Region: 229-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-like domain of nidogen-1 0.071
Further Details:      
 
Domain Number - Region: 173-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0664
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0811
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007262   Gene: ENSNLEG00000005980   Transcript: ENSNLET00000007621
Sequence length 752
Comment pep:known_by_projection supercontig:Nleu1.0:GL397382.1:4024447:4036011:-1 gene:ENSNLEG00000005980 transcript:ENSNLET00000007621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPETACVLLLTLAALGASGQSQIPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTD
INECETGQHNCVPNSVKKGSREGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHE
HADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSG
QEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQ
KDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQA
DVDHDFVGDACDSDQDQKEATRGGRPGPLTKRSGELIEDADSTAGAGPWGLLGWGLRWAG
PDLSPPRGAPTSKDGVCHVCQDHFDAKVVDKIDLCPENAEVTLTDFRAFQTVVLDPEGDA
HIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQD
SSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVR
LLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVF
CFSQENIIWANLRYRCNDTIPEDYETHQLRRA
Download sequence
Identical sequences ENSNLEP00000007262 ENSNLEP00000007262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]