SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007281 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007281
Domain Number 1 Region: 1257-1388
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-33
Family Cadherin 0.00066
Further Details:      
 
Domain Number 2 Region: 1775-1896
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-33
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 1980-2101
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.0052
Further Details:      
 
Domain Number 4 Region: 827-964
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-27
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 2204-2314
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 1158-1262
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-27
Family Cadherin 0.0029
Further Details:      
 
Domain Number 7 Region: 1368-1470
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 1043-1165
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 1472-1575
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 680-745,790-841
Classification Level Classification E-value
Superfamily Cadherin-like 2.83e-22
Family Cadherin 0.0056
Further Details:      
 
Domain Number 11 Region: 2308-2414
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 12 Region: 468-579
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 2087-2203
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 376-480
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-18
Family Cadherin 0.0054
Further Details:      
 
Domain Number 15 Region: 1885-1984
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-18
Family Cadherin 0.00093
Further Details:      
 
Domain Number 16 Region: 1571-1676
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-17
Family Cadherin 0.007
Further Details:      
 
Domain Number 17 Region: 2413-2532
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000343
Family Cadherin 0.0034
Further Details:      
 
Domain Number 18 Region: 948-1055
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000343
Family Cadherin 0.0052
Further Details:      
 
Domain Number 19 Region: 170-232
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000101
Family Cadherin 0.0011
Further Details:      
 
Domain Number 20 Region: 584-692
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000108
Family Cadherin 0.0063
Further Details:      
 
Domain Number 21 Region: 67-177
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000011
Family Cadherin 0.0026
Further Details:      
 
Domain Number 22 Region: 1684-1787
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000971
Family Cadherin 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007281
Domain Number - Region: 326-369
Classification Level Classification E-value
Superfamily Cadherin-like 0.0366
Family Cadherin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007281   Gene: ENSNLEG00000006005   Transcript: ENSNLET00000007641
Sequence length 2916
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:20413530:20583248:-1 gene:ENSNLEG00000006005 transcript:ENSNLET00000007641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLDEITKPENEDGEKKMFTQQFESTDACVYVAYVKINSISPTSSQSGLKRSSPKTELWG
AIVFRSQEENTKPVKETEVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICV
SQDIDRERDPATYDLLVKAKDGDEQRMTHLALVKGGLSAQAFVRVDLEDVNDNHPMFNPS
TYVTSISGETQPGTEIINVLATDQDSGIYGTVAYELIPGDVSSLFTIDSTTGLYSPEVEI
LSTVRFSVDKEVMNCLEMFLPLLRHLKKAERDEEAAEKKFEASRGWFMRFKGRRHLRYLK
VQGEAASADGEAAAKYLENLAKIIGEGIIYLTSPLSHLESTTLSLMVSAQDGGGLTAVIN
ADVTIYIFQTTLAPAEFERHKYTFLVYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDL
GGKFSIHPWLGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSSTEVNITVVDVNDNHPAF
LRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIAGPQPGVFAIDRALGVLFLNG
SLGAGEHRELTLTLRAEDQGVPPQAALLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSP
MTQILQTQAHPLGPQRAASPLRYSLEPSVDSAIFGIRPYTGWIYLRRQFDYESTQTYNFR
VFAWIPEDGLLQNVSTTVIVRVRDENDNSPTFLNDVLFLKVEESPVPQGVISKITAIDID
SGKNGQLLYFLLSDGKFFKMNPNTGPAGTIYVISWADGAAAFSGTDFAFSSDELQAFVLK
FLFCGLGEGELINWVALDREHRGHHQMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFP
QCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVIYSVSSEDSPDHFKIDANSGEI
RTTTILSYDYRPSYRMTVIATDQGVPPLQGQAVVNIQVIPLSKGRAIMSQNIRHLVIPEN
SKPAKVMSLIKSPDHLQQHYNGKLHFSIVADDKDGHFEIDSSTGDLFLSKELDYETTSHY
LFRVITTDHSKNLSLSSTVFLNIDVEDQNDHSPSFQDELIVISVEENVPVGTLVYVFNAK
DGDGSFLNSRIQYHIESHNPGTNPFLIHPSFGTLVTVSPLDRESIPTVILTVTASDQAVN
VTDRRLRSLTAQIVILDVNDHNPTFMSFPIAHVKEDVTVGSLVHHITAHDPDEGRNGKVT
YSILSGNENMAFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTITVL
DVNDEAPVFKQHLYEASVKENRNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFESFQIN
SDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYD
IEILENQEPEVVYTVLASDMDAGNNRAVEYHIIDGNTDEYFAINEMSGELSTTRALDREQ
VSNFTLAILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSMREDAEVGTVVLVL
SAVDKDEGLNGQTEYFLTDEASGAFTIDPMSGTLRTSNTLNREARSQHTFSAVARDCSIQ
DSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPQSPTNQTTVIVRADDPDLGPNGTVVF
SFAETQSMFSIDKYTGEIQFQQNPSSEYFPIWLQLKVTDQGVPARTTTGLLVIHMEGEDV
KISFSHHLYKGLVTENCEADTSIVTVKAFAPDSIQDSMKYSIFSGNEDGVLSLCSKSGQL
TVKEPKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPCFEQSVYQAAVSEGQ
LYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAMLDYELTSTYSL
IVQATDKGIPRLSNTTIIKVQVTDINDNAPAFLTSEAVEIAEDSLPGVIVTHVSVHDVDL
NSAFIFSFAKESNPGTKFAIDQNTGVVVLVKTLDFEEMTEYELLIQISDSVHHTEGALVV
RVLDVNDNPPVFSQDFYQVTVPESIPVGYSVLTLSATDLESNENISYRILSSSKEFSIDP
KNGTIFTSSPVLFLDTISTTQFLVEASDGGNPDLRALTLVEIGIQDMNNYAPEFTVKSYN
LSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNLQNNFHVETNFFHSEYPYKQVG
YLVLLHSMDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVK
ESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIKPLDYEEMTK
FTLTIQASDAEKKHISFAVVFVNVLDDNDHAPQFMFSSYSCIVPENLPISSTICSINALD
FDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTIQAK
DKGDATASLVVWVDIEGIDEFEPVFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVI
LYSLGTSSPFFSVNKTNGNIYLIRALPLIKSQLNKEDTMEMKIIAHSPKSDSKFASCTVF
VNVSFSSEGTPLAVFASSFSVSLVVSFLVFLILVCTLIVMILRHKQKDTRNNYEEKKTSS
LDMDLGVTRDASVLKAFQKTDNCSNEVVPVDATPEWLSLISIMEKDIVNLYRHSNSSGHC
SVEGETAEDKEIQRINEHPYRKGSDSALSDHESRVPDSGIPRDSDQLSCLSGETEVMVTA
ETAVASQTFGEGDQGEGCSTTCAQNNVLPQTVQKREAKESILADVRKESVFISGDQEVQC
AALSTQTTSDHDGRGNYHWNYLLSWEPKFQPLASVFNDIAKLKDEHLHMPGIPKEKKSFV
FPPPLITAVAQPGIKAVPPRMPAVTLRQVPPKHPRSPIPYHLGSLPEAMTPNFSPSLSLL
TMQPPALSPLLSAGELLGTHVSGTCHELKAEDEIQI
Download sequence
Identical sequences ENSNLEP00000007281 ENSNLEP00000007281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]