SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007284 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007284
Domain Number 1 Region: 285-415
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-31
Family Cadherin 0.00083
Further Details:      
 
Domain Number 2 Region: 528-675
Classification Level Classification E-value
Superfamily Cadherin-like 2.01e-28
Family Cadherin 0.00052
Further Details:      
 
Domain Number 3 Region: 160-288
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000007
Family Cadherin 0.0054
Further Details:      
 
Domain Number 4 Region: 401-531
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000443
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 70-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000005
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007284   Gene: ENSNLEG00000026943   Transcript: ENSNLET00000007644
Sequence length 704
Comment pep:novel supercontig:Nleu1.0:GL397272.1:20677944:20683385:-1 gene:ENSNLEG00000026943 transcript:ENSNLET00000007644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSSARTQSSLLWLLVHVWLWAAS
GSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHP
DTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPGAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTLGPLPSPLLPGSS
SPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGRLSVELRVLDENDNPPVFEQDE
YRVAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVRRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTE
GGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELDVGLGDGSISLSLEGGEGDFAL
LPGGSPGVFFLCVEGTLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGTDHSWLRYTVVQLSAPCNQGALPTAECGPS
FAIDSESGAISTIQTLDREVQEAVELRVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWR
QVYNATIAEHAPVGHCFLQLISAQVAFVKIKQKQKEIQEKQNIS
Download sequence
Identical sequences ENSNLEP00000007284 XP_003257905.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]