SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007285 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007285
Domain Number 1 Region: 145-456
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-116
Family Transglutaminase core 0.0000000498
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily E set domains 4.2e-39
Family Transglutaminase N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 585-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.18e-22
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 
Domain Number 4 Region: 473-579
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000706
Family Transglutaminase, two C-terminal domains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007285   Gene: ENSNLEG00000006002   Transcript: ENSNLET00000007645
Sequence length 684
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:33371292:33410653:1 gene:ENSNLEG00000006002 transcript:ENSNLET00000007645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDTSKELQVLHVDFLKQENAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKL
EFSTGPNPSIAKHTLVVLDPRMPSAHYNWQAALQNESGKEVTVAVTSTPNAILGKYQLNV
KTGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWN
FGQFEENVLDCCISLLTESSLKPTDRRDPVLVCRAMSAMMSFEKGQGVLIGNWTGDYQGG
TAPYKWTGSAPILQQYYNTKQPVCFGQCWVFAGILTTVLRALGIPARSVTAFDSAHDTER
NLTVDTYVNKNGEKITNMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGV
FCCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRIIWLVKMVNGQEELHIISMETTSIGKN
ISTKAVGQDGRRDITYEYKYPEGSSEERQVMDHAFLLLSSEREHRQPVKENFLHMSVQSD
DVLLGNPVNFTVIIKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVT
LTLDSKTYINSLAILDDEPVIRGFIIAEIVESNEIMASEVFTSFQYPEFSIELPNTGRIG
QLLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQIKCAPIKTGPK
KFIIKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences G1R263
ENSNLEP00000007285 ENSNLEP00000007285 XP_003257008.1.23891 XP_012353402.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]