SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007315 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000007315
Domain Number - Region: 232-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000127
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number - Region: 557-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0366
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007315   Gene: ENSNLEG00000006040   Transcript: ENSNLET00000007676
Sequence length 836
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:33579556:33642180:-1 gene:ENSNLEG00000006040 transcript:ENSNLET00000007676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLNCGVPIALLGVLLLGAARLPRGAEAFEIALPRESNITVLIKLGTPTLLAKPCYIVI
SKRHVTMLSIKSGERIVFTFSCQSPENHFVIEIQKNIDCISGPCPFGEVQLQPSTSLLPT
LNRTFIWDVKAHKSIGLELQFSVPRLRQIGPGESCPDGVTHSISGRIDATVVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHPRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PEGFPEDELMTWQFVIPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDK
QPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERAMSLTIE
PRPVKQSCKFVPGCFVCLESRTCSSNLTLTSGSKHKISFLCDDLTRLWMNVEKTISCTDH
RYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSF
SYLVASAIPSQDLYFGSFCPGGSIEQIQVKQNISVTLRTFAPSFRQEASRQGLTVSFIPY
FKEEGVFTVTPDTKSKVYLRTPNWDRGLPSLTSVSWNISVPRDQVACLTFFKERTGVVCQ
TGRAFMIIQEQRTRAEEIFSLDEDVLPKPSFHHHSFWVNISNCSPASGKQLDLLFSVTLT
PRTVDLTVILIAVVGGGALLLSALGLIICCVKKKKKKTNKGLAVGVYNGNINTEMPRQPK
KFQKGRKDNDSHVYAVIEDTMVYGHLLQDSGGSFLQPEVDTYRPFQGTMGVCPPSPPTIC
SRAPTAKLATEELPPCSPPESESEPYTFSHPNNGDVSSKDTDIPLLNTQEPMEPAE
Download sequence
Identical sequences A0A2I3HNA8
XP_003257015.1.23891 ENSNLEP00000007315 ENSNLEP00000007315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]