SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007346 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007346
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.18e-82
Family MHC antigen-recognition domain 0.0000000204
Further Details:      
 
Domain Number 2 Region: 208-300
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-31
Family C1 set domains (antibody constant domain-like) 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007346   Gene: ENSNLEG00000005839   Transcript: ENSNLET00000007710
Sequence length 365
Comment pep:novel supercontig:Nleu1.0:GL397342.1:8159931:8164802:-1 gene:ENSNLEG00000005839 transcript:ENSNLET00000007710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVMAPRTLLLLLSAALALTETWAGSHSMRYFSTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKATAQTDRENLGTLRGYYNQSEDGSHTLQ
RMYGCDVGPDGRLLRGYRQDAYDGKDYLALNEDLSSWTAADTAAQISKRKWEAAREAEQR
RPYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLREPLTKRWEP
SSQSTIPIVGIVAGLAVLAVVVIGAVVAAVMWRRKSLGGKGGSYSQAASSDSAQGSDESL
MACKA
Download sequence
Identical sequences G1R2C4
ENSNLEP00000007346 XP_003272127.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]