SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007359 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007359
Domain Number 1 Region: 607-914
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.55e-115
Family PDEase 0.000000076
Further Details:      
 
Domain Number 2 Region: 198-397
Classification Level Classification E-value
Superfamily GAF domain-like 7.2e-47
Family GAF domain 0.0000955
Further Details:      
 
Domain Number 3 Region: 381-583
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-42
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007359   Gene: ENSNLEG00000006056   Transcript: ENSNLET00000007724
Sequence length 932
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:21615593:22047346:-1 gene:ENSNLEG00000006056 transcript:ENSNLET00000007724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHRQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPPGGGDCVGVPLSPSWASGSRGDGNLQRRASQKEL
RKSFARSKAIPVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRVN
LPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSLF
LVEGAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIPD
AYQDRRFNDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKIPEGAPFTEDDEKVMQM
YLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCE
RCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSVAELVAS
TGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDD
ADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIP
LVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMV
LYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGS
ALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYF
ERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQ
GDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICLPLYQALVKVNVKLKPMLDSVATN
RSKWEELHQKRLLASTASSSPTSVMVAKEDRN
Download sequence
Identical sequences G1R2D7
ENSNLEP00000007359 ENSNLEP00000007359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]