SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007362 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007362
Domain Number 1 Region: 605-911
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.08e-73
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 961-1237
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-52
Family WD40-repeat 0.00067
Further Details:      
 
Domain Number 3 Region: 107-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-45
Family Extended AAA-ATPase domain 0.044
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-24
Family Caspase recruitment domain, CARD 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007362   Gene: ENSNLEG00000006016   Transcript: ENSNLET00000007727
Sequence length 1248
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:34352862:34453818:1 gene:ENSNLEG00000006016 transcript:ENSNLET00000007727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEVVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYIDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFCYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWCNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSRRLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVTSANERKS
INVKQFFLNSEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGILREIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNIDSCSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGKTGQINYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRIRHKTTVWHIEFTADEKTLIS
SSDDSEIQVWNWHLDKFIFLRAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIVTGNKEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Download sequence
Identical sequences G1R2E0
ENSNLEP00000007362 ENSNLEP00000007362 XP_003259754.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]