SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007445 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007445
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000248
Family V set domains (antibody variable domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007445   Gene: ENSNLEG00000006134   Transcript: ENSNLET00000007811
Sequence length 201
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:8378634:8382415:-1 gene:ENSNLEG00000006134 transcript:ENSNLET00000007811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV
VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIWDVRGHDASIYVCRVEVLGLGVGTG
NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV
PGPLPPPCGSSAHPLPPVPGG
Download sequence
Identical sequences ENSNLEP00000007445 ENSNLEP00000007445 XP_003272146.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]