SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007481 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007481
Domain Number 1 Region: 20462-20751
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-69
Family Protein kinases, catalytic subunit 0.0000000000558
Further Details:      
 
Domain Number 2 Region: 6227-6421
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-46
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 3 Region: 19542-19732
Classification Level Classification E-value
Superfamily Fibronectin type III 1.08e-45
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 4 Region: 2998-3194
Classification Level Classification E-value
Superfamily Fibronectin type III 2.66e-45
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 5 Region: 9786-9975
Classification Level Classification E-value
Superfamily Fibronectin type III 2.76e-45
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 6 Region: 8702-8895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-45
Family Fibronectin type III 0.00047
Further Details:      
 
Domain Number 7 Region: 7511-7708
Classification Level Classification E-value
Superfamily Fibronectin type III 5.13e-45
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 5432-5633
Classification Level Classification E-value
Superfamily Fibronectin type III 7.74e-45
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 9 Region: 11166-11358
Classification Level Classification E-value
Superfamily Fibronectin type III 7.74e-45
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 10 Region: 7913-8103
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-44
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 11 Region: 5126-5329
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-44
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 12 Region: 14413-14598
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-44
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 13 Region: 15197-15393
Classification Level Classification E-value
Superfamily Fibronectin type III 2.1e-44
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 14 Region: 10769-10964
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-44
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 15 Region: 14117-14306
Classification Level Classification E-value
Superfamily Fibronectin type III 3.34e-44
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 16 Region: 10082-10272
Classification Level Classification E-value
Superfamily Fibronectin type III 4.02e-44
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 17 Region: 3198-3388
Classification Level Classification E-value
Superfamily Fibronectin type III 7.5e-44
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 18 Region: 12537-12735
Classification Level Classification E-value
Superfamily Fibronectin type III 9.38e-44
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 19 Region: 4016-4214
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-43
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 20 Region: 19147-19336
Classification Level Classification E-value
Superfamily Fibronectin type III 2.12e-43
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 21 Region: 9291-9486
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-43
Family Fibronectin type III 0.00045
Further Details:      
 
Domain Number 22 Region: 2703-2894
Classification Level Classification E-value
Superfamily Fibronectin type III 3.2e-43
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 23 Region: 13620-13817
Classification Level Classification E-value
Superfamily Fibronectin type III 4.27e-43
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 24 Region: 3695-3888
Classification Level Classification E-value
Superfamily Fibronectin type III 5.44e-43
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 25 Region: 11851-12047
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-43
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 26 Region: 6524-6713
Classification Level Classification E-value
Superfamily Fibronectin type III 8.69e-43
Family Fibronectin type III 0.00083
Further Details:      
 
Domain Number 27 Region: 12248-12439
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-42
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 28 Region: 14702-14896
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-42
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 29 Region: 12933-13129
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-42
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 30 Region: 10373-10568
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-42
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 31 Region: 6818-7008
Classification Level Classification E-value
Superfamily Fibronectin type III 3.08e-42
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 32 Region: 17662-17852
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-42
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 33 Region: 16870-17066
Classification Level Classification E-value
Superfamily Fibronectin type III 4.33e-42
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 34 Region: 15492-15679
Classification Level Classification E-value
Superfamily Fibronectin type III 4.46e-42
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 35 Region: 16380-16481,16572-16678
Classification Level Classification E-value
Superfamily Fibronectin type III 5.55e-42
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 36 Region: 2304-2500
Classification Level Classification E-value
Superfamily Fibronectin type III 5.86e-42
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 37 Region: 8206-8402
Classification Level Classification E-value
Superfamily Fibronectin type III 6.63e-42
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 38 Region: 11455-11653
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-42
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 39 Region: 13330-13512
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-41
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 40 Region: 18454-18647
Classification Level Classification E-value
Superfamily Fibronectin type III 1.32e-41
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 41 Region: 4712-4914
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-41
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 42 Region: 9001-9188
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-41
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 43 Region: 16179-16377
Classification Level Classification E-value
Superfamily Fibronectin type III 4.4e-41
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 44 Region: 18751-18946
Classification Level Classification E-value
Superfamily Fibronectin type III 4.4e-41
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 45 Region: 15784-15978
Classification Level Classification E-value
Superfamily Fibronectin type III 5.55e-41
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 46 Region: 19936-20135
Classification Level Classification E-value
Superfamily Fibronectin type III 6.25e-41
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 47 Region: 3399-3598
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-41
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 48 Region: 17955-18152
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-41
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 49 Region: 17267-17456
Classification Level Classification E-value
Superfamily Fibronectin type III 2.19e-40
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 50 Region: 5637-5735,5823-5924
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-39
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 51 Region: 9491-9592,9680-9775
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-39
Family Fibronectin type III 0.0000614
Further Details:      
 
Domain Number 52 Region: 13818-13918,14009-14106
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-38
Family Fibronectin type III 0.0000208
Further Details:      
 
Domain Number 53 Region: 4411-4606
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-38
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 54 Region: 5931-6031,6119-6213
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-37
Family Fibronectin type III 0.00044
Further Details:      
 
Domain Number 55 Region: 7216-7412
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-36
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 56 Region: 18155-18259,18347-18442
Classification Level Classification E-value
Superfamily Fibronectin type III 4.67e-36
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 57 Region: 8407-8506,8596-8689
Classification Level Classification E-value
Superfamily Fibronectin type III 6.43e-36
Family Fibronectin type III 0.000077
Further Details:      
 
Domain Number 58 Region: 14900-15003,15090-15191
Classification Level Classification E-value
Superfamily Fibronectin type III 7.35e-34
Family Fibronectin type III 0.0000479
Further Details:      
 
Domain Number 59 Region: 15973-16085
Classification Level Classification E-value
Superfamily Fibronectin type III 3.23e-28
Family Fibronectin type III 0.0000532
Further Details:      
 
Domain Number 60 Region: 20325-20432
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-26
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 61 Region: 2499-2603
Classification Level Classification E-value
Superfamily Fibronectin type III 2.02e-26
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 62 Region: 11646-11758
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-26
Family Fibronectin type III 0.0000223
Further Details:      
 
Domain Number 63 Region: 12720-12839
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-24
Family Fibronectin type III 0.0000189
Further Details:      
 
Domain Number 64 Region: 17454-17559
Classification Level Classification E-value
Superfamily Fibronectin type III 6.76e-24
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 65 Region: 4916-5011
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-24
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 66 Region: 19428-19547
Classification Level Classification E-value
Superfamily Fibronectin type III 9.89e-24
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 67 Region: 10567-10675
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-23
Family Fibronectin type III 0.00000193
Further Details:      
 
Domain Number 68 Region: 17067-17167
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-23
Family Fibronectin type III 0.0000762
Further Details:      
 
Domain Number 69 Region: 10970-11058
Classification Level Classification E-value
Superfamily Fibronectin type III 5.9e-23
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 70 Region: 19031-19138
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-23
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 71 Region: 7700-7820
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-22
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 72 Region: 6732-6826
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 73 Region: 13132-13228
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-22
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 74 Region: 12050-12158
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-22
Family Fibronectin type III 0.00048
Further Details:      
 
Domain Number 75 Region: 19748-19844
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 76 Region: 7005-7131
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-21
Family Fibronectin type III 0.00091
Further Details:      
 
Domain Number 77 Region: 4211-4311
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-21
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 78 Region: 1493-1586
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-21
Family I set domains 0.0041
Further Details:      
 
Domain Number 79 Region: 21008-21101
Classification Level Classification E-value
Superfamily Immunoglobulin 3.83e-21
Family I set domains 0.0056
Further Details:      
 
Domain Number 80 Region: 13528-13627
Classification Level Classification E-value
Superfamily Immunoglobulin 8.06e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 81 Region: 8521-8609
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 82 Region: 20904-21003
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 83 Region: 11364-11463
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-20
Family I set domains 0.0048
Further Details:      
 
Domain Number 84 Region: 8115-8214
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-20
Family I set domains 0.0078
Further Details:      
 
Domain Number 85 Region: 3603-3701
Classification Level Classification E-value
Superfamily Immunoglobulin 6.14e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 86 Region: 20140-20235
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-19
Family I set domains 0.0074
Further Details:      
 
Domain Number 87 Region: 12849-12941
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 88 Region: 2913-3003
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 89 Region: 5340-5439
Classification Level Classification E-value
Superfamily Immunoglobulin 6.93e-19
Family I set domains 0.0073
Further Details:      
 
Domain Number 90 Region: 16495-16586
Classification Level Classification E-value
Superfamily Immunoglobulin 9.36e-19
Family I set domains 0.0078
Further Details:      
 
Domain Number 91 Region: 17870-17962
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 92 Region: 12450-12545
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-18
Family I set domains 0.032
Further Details:      
 
Domain Number 93 Region: 10685-10777
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 94 Region: 6042-6134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 95 Region: 11767-11859
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 96 Region: 14611-14708
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 97 Region: 18958-19053
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 98 Region: 9603-9693
Classification Level Classification E-value
Superfamily Immunoglobulin 4.67e-18
Family I set domains 0.0094
Further Details:      
 
Domain Number 99 Region: 879-965
Classification Level Classification E-value
Superfamily Immunoglobulin 7.02e-18
Family I set domains 0.0045
Further Details:      
 
Domain Number 100 Region: 9209-9298
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-17
Family I set domains 0.0085
Further Details:      
 
Domain Number 101 Region: 7133-7223
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 102 Region: 10290-10381
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-17
Family I set domains 0.0068
Further Details:      
 
Domain Number 103 Region: 17182-17273
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 104 Region: 4622-4719
Classification Level Classification E-value
Superfamily Immunoglobulin 2.46e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 105 Region: 7421-7518
Classification Level Classification E-value
Superfamily Immunoglobulin 3.87e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 106 Region: 15013-15105
Classification Level Classification E-value
Superfamily Immunoglobulin 4.55e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 107 Region: 13932-14024
Classification Level Classification E-value
Superfamily Immunoglobulin 4.85e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 108 Region: 6442-6531
Classification Level Classification E-value
Superfamily Immunoglobulin 5.86e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 109 Region: 1234-1326
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-17
Family I set domains 0.0041
Further Details:      
 
Domain Number 110 Region: 16787-16878
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 111 Region: 2034-2123
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-16
Family I set domains 0.0062
Further Details:      
 
Domain Number 112 Region: 347-430
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 113 Region: 16676-16767
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-16
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 114 Region: 1415-1506
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-16
Family I set domains 0.0037
Further Details:      
 
Domain Number 115 Region: 1677-1754
Classification Level Classification E-value
Superfamily Immunoglobulin 2.45e-16
Family I set domains 0.0088
Further Details:      
 
Domain Number 116 Region: 16095-16187
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-16
Family I set domains 0.0048
Further Details:      
 
Domain Number 117 Region: 18669-18756
Classification Level Classification E-value
Superfamily Immunoglobulin 6.49e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 118 Region: 1592-1676
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000013
Family I set domains 0.0056
Further Details:      
 
Domain Number 119 Region: 15410-15499
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000175
Family I set domains 0.0087
Further Details:      
 
Domain Number 120 Region: 18272-18359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000195
Family I set domains 0.016
Further Details:      
 
Domain Number 121 Region: 17580-17668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000205
Family I set domains 0.0078
Further Details:      
 
Domain Number 122 Region: 1952-2040
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000263
Family I set domains 0.022
Further Details:      
 
Domain Number 123 Region: 13248-13338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000296
Family I set domains 0.021
Further Details:      
 
Domain Number 124 Region: 5749-5838
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000303
Family I set domains 0.0097
Further Details:      
 
Domain Number 125 Region: 1770-1855
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000426
Family I set domains 0.018
Further Details:      
 
Domain Number 126 Region: 4330-4418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000472
Family I set domains 0.0076
Further Details:      
 
Domain Number 127 Region: 1054-1137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000582
Family I set domains 0.01
Further Details:      
 
Domain Number 128 Region: 20243-20342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000988
Family I set domains 0.014
Further Details:      
 
Domain Number 129 Region: 19853-19944
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000114
Family I set domains 0.013
Further Details:      
 
Domain Number 130 Region: 12168-12255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000152
Family I set domains 0.018
Further Details:      
 
Domain Number 131 Region: 1857-1949
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000282
Family I set domains 0.023
Further Details:      
 
Domain Number 132 Region: 791-877
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000291
Family I set domains 0.016
Further Details:      
 
Domain Number 133 Region: 20794-20876
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000367
Family I set domains 0.0094
Further Details:      
 
Domain Number 134 Region: 2216-2311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000642
Family I set domains 0.0087
Further Details:      
 
Domain Number 135 Region: 2620-2709
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000151
Family I set domains 0.026
Further Details:      
 
Domain Number 136 Region: 14333-14420
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000185
Family I set domains 0.047
Further Details:      
 
Domain Number 137 Region: 15699-15790
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000222
Family I set domains 0.011
Further Details:      
 
Domain Number 138 Region: 10000-10089
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000284
Family I set domains 0.014
Further Details:      
 
Domain Number 139 Region: 7830-7919
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000326
Family I set domains 0.033
Further Details:      
 
Domain Number 140 Region: 8918-9008
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000465
Family I set domains 0.027
Further Details:      
 
Domain Number 141 Region: 3903-3938,3967-4023
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000469
Family I set domains 0.019
Further Details:      
 
Domain Number 142 Region: 19359-19449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000516
Family I set domains 0.02
Further Details:      
 
Domain Number 143 Region: 5036-5133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000523
Family I set domains 0.0076
Further Details:      
 
Domain Number 144 Region: 11086-11173
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000308
Family I set domains 0.023
Further Details:      
 
Domain Number 145 Region: 420-517
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000001
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 
Domain Number 146 Region: 704-787
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000214
Family I set domains 0.018
Further Details:      
 
Domain Number 147 Region: 2125-2205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000231
Family I set domains 0.029
Further Details:      
 
Domain Number 148 Region: 1144-1229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000826
Family I set domains 0.008
Further Details:      
 
Domain Number 149 Region: 970-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000552
Family I set domains 0.00000997
Further Details:      
 
Domain Number 150 Region: 524-600
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000161
Family I set domains 0.011
Further Details:      
 
Domain Number 151 Region: 616-699
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000306
Family I set domains 0.00046
Further Details:      
 
Domain Number 152 Region: 1326-1408
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000037
Family I set domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007481   Gene: ENSNLEG00000006156   Transcript: ENSNLET00000007848
Sequence length 21538
Comment pep:novel supercontig:Nleu1.0:GL397263.1:22537866:22658406:-1 gene:ENSNLEG00000006156 transcript:ENSNLET00000007848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKKVVPVKKVPTVKKPETPAAKAPEVPKKLVPVKKEPVPVTKKPEVLPEKVPKVPEKII
PEKEVSVPIPAEPEAPPAEVEETPEEIIYEEKASITIGRKETPPVEEREIEKYIKPEEPE
PEPQPEEIPVKEPEPEKKVIEKPKLKPRPPPPPPAPPKEDVKEKIFQLKAIPKKKVPEKP
AVPEKVELTPLKVPEPPPPKPVEEVEVPTVTKRERKIPEPTKVPEIKPAIPLPAPEPKPK
PEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVAKKTPSPI
EAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTESEFVGSSAIFECLVSP
STAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAK
LVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIG
LMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAI
FACDIAKDTPNIKWFKGYDEIPTEPNDKTEILRDGNHLFLKIKNAMPEDVDEYAVEIEGK
RYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEI
KAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQAR
FECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTS
ARLFVTGIRLKFMTPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSE
GKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKC
EVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKAELKDKGEYVCDCGTDKTKANV
TVEARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKK
HILILHNCQLGMTGEVSFQAANAKSAASLKVKELPLIFITPLSDVKVFEKDEAKFECEVS
REPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLII
EGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHS
ITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKA
DAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIED
REIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLV
LHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDI
PVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPP
VEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIH
GCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKV
KWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAV
FTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNA
HLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQW
KRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVV
PLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDARLD
DQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTL
KWTKNGEEVPFDNRVSYRIDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTE
FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC
RLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQW
LRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKT
ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKEDK
GRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGY
VVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEA
RSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVR
AEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQT
QSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLY
RVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRP
TATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNV
IARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDL
EFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVPDPPENVKWRDRTANSI
FLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKAL
NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITW
TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKP
GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFKA
TKLIPNKEYIFRVAAENMYGVGEPVQATPITAKYQFDPPGPPTRLEPSDITKDAVTLTWC
EPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAG
PGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVKLNWTKPEHDGGAKIESYVIEMLK
TGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPP
SPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTV
TPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKW
EPPKNDGGRPIQRYIIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEA
GVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMC
PVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPD
CKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHL
EVPKSVHADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPE
FDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEY
IELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEE
RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI
LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE
PFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGP
PINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSDWIVVTSTLRHCKYSV
TKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWN
EPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGP
GKFSPPSDPKTARDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVG
TNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEPPTV
ELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRIVIDNVGTKSELIIK
DALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDG
GSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIG
PILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERV
NKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVR
GDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSI
PKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDN
GGSEITHYIIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDE
CKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPY
WSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFP
PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPVKGYIVEMQEEGTTDWKRVNEPDKLITTC
ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA
GSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRS
HTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIK
GYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTT
ARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWR
QCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPVTVKDQTCPPSIDLKE
FMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIP
QSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSAEQMTLSWFPPKDD
GGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLD
SEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWK
RVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPIAPPGP
PFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG
LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVLPDLQLDASVRDRIVVHAGGVIRI
IAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGIYSLLAKNEAGER
KKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPVTNYVIEKRESDRRAWT
PVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLE
VKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEG
DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSG
KPKPKVSWFKDEADVLEDDRTHIKTTPTTLALEKIKAKRSDSGKYCVVVENSTGSRKGFC
QVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEVGKDVWMPVTS
ASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVT
KDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEF
RVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKI
LGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNEAGESDPAHVP
EPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKAR
IDVTPVGSKLEIHNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKD
SCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVA
AENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGY
LVEYQEEGTQDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEK
LVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTIETDNF
SSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTIS
WQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKI
GVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERRE
VTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPP
GPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAF
RVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQ
TIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAK
NSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPN
QKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEP
ENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDR
CVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAG
VRGKPFPEVAWTKDKDATDLTRSPRVKIDTWADSSKFSLTKAKRSDGGKYVVTATNTAGS
FVAYATVNVLDKPGPVRNLKIVDVSSDRCTVRWDPPEDDGGCEIQNYILEKCETKRMVWS
TYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEV
TKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDH
EYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDG
GAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVG
IGRPAELKEAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRKVG
IDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSD
LKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVP
GNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLR
DGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLP
REAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSH
LAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDI
DADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIF
RVRAENRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPII
GYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV
TARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPH
QIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSL
LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG
DYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYI
VDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNP
YDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIE
RTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSS
VSLSWGKPAYDGGSPIIGYLVEVKRAESDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRV
YAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPK
ITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVL
DTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTS
FRVPNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVTKSSCSIGW
KKPHSDGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEG
TPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLA
TDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIK
FDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGM
EYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGG
SPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLP
SEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKAN
HVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTDTIICKDEYEAPTIVLDPTI
KDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATR
KDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPI
KSYTLEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVK
MIDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKT
PVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASNSVLMKDAAYPPGPPSNPHVTDT
TKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKY
NFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRP
APEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRV
LDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKC
TYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLA
WPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEGEEYTFQVMAVNSAG
RSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ
FLKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTG
PIKFDEVSSDFVTFSWDPPEDDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLT
TGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLS
DGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKP
SKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWL
KANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVD
VKFKDTVILKAGEAFRLEADVSGRPPPTMEWTKDGKELEGTAKLEIKIADFSTNLVNKDS
TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWLPPLDDGG
AKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESE
PVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKC
NKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRV
LDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTEN
QEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPI
KGRPAPEVKWAREHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFV
NVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN
CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNS
VSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQ
NEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEELKVDVPFIGRPTPAVTWHKD
DVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEATETLNVIVLDKPGPP
TGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACR
LKTGCEYQFRIAAENRYGKSTYLNSEPIVAQYPFKVPGPPGTPLVTLSSRDSMEVQWNEP
VSDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIG
KPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGR
WMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRIS
MDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVK
DAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQD
GGSDIINYIVEKRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE
SEPVIAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWT
RCHKRLIGELRLRVTGLIENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNP
KVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLL
EKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFV
PIKGRPTPEVKWGKMDGEIRDAAVIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSA
FVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVV
TNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTR
NSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLEAVITNLTQGEEYLFRVV
AVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWT
KDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPD
PPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKV
TKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWH
EPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVG
VGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPD
GRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPR
ISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLI
VKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPL
QDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYIFRIMAVNKYGVGEP
LESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIR
WIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPT
NAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISK
LTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARI
HIPFKGRPTPEITWSREEGEFTDKVQTEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSK
SAFVTVKVLDTPGPPQNLAVKEVRKDSVFLVWEPPIIDGGAKVKNYVIDKRESTRKAYAN
VSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDV
SQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFR
VKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNIS
WVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTITATNSAGTATENLSVIVLEK
PGPPVGPVRFDEVSADFVIISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTI
KITKLKTGTEYQFRIFAENRYGKSAPLDSKPVIVQYPFKEPGPPGTPFVTSISKDQMLVQ
WHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENI
VGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDL
PDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSESSGAITARDEIDA
PNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKT
TLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKITGVTAEKCYLAWN
PPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYVFRVMAVNKYGI
GEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGAEIEGYILEKRDKE
GVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPG
PPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEAKEAAADEWTTCTPPTGLQGKQFT
VTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASAT
LRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNS
GSKTAFVNVRVLDSPSAPVNLTVREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKA
YATVTNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTL
VDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEY
VFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQA
TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASREDVGTYELCVSNSAGSITVPITVIV
LDKPGPPGPIRIDEVSCDSITISWNPPEYDGGCHISNYIVEKKETTSTTWHVVSQAVART
SIKIVRLTTGSEYLFRVCAENRYGKSSYSESSAVVAAYPFSPPGPPGTPKVVHATKSTML
VTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAE
NIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERR
ELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDV
EAPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNH
TLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSW
GRPQEDGGADIDYYIVEKRETSHLAWTICEGELRTTSCKVTKLLKGNEYIFRVTGVNKYG
VGEPLESVAVKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREK
NSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP
SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTI
SGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASF
TMTVPFRGRPVPNVLWSKPDTDLRTRAYIDTTDSRTSLTIENANRNDSGKYTLTIQNVLS
AASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAW
VSVTNNCNRLSYKVTSLQEGAIYYFRISGENEFGVGIPAETKEGVKITEKPSPPEKLGVT
SITKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRENSEYF
FRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKP
LPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINI
VVLDRPGPPTPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVA
RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTMPGPPSTPWVTNVTRES
ITVGWHEPVSNGGSAVIGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVY
AENAAGVGKPSHPSEPVLAIDACEPPRNVRVTDISKNSVSLSWQQPAFDGGSKITGYIVE
RHDLPDGRWTKASFTNVTETQFTISGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCID
SYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTT
DLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITL
LWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNK
YGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKR
DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAINAAGQGPFSEPSEFYKAADPID
PPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEMRQGEEEEWTTVSTKGEVRTT
EYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMTEAVQAKDILEAPEIDLDVALRTSVIAKA
GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRSDTGKYILT
IENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKR
DATKRTWSVVSHKCSSTSFKLTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAP
IRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQL
KEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLEL
PYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRN
AVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWK
MVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVI
YNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNISPISGREYRATGLVEGL
DYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTLDYIDVTRETITLKWNPPLRDGGSK
IVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSG
IIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNM
EITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRITNIT
GEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFR
VSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNVTGNSITLTWARPESDGGSEIQQ
YILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPAGGISRLI
KCREPVNPPGPPAVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNA
EACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQ
THVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGK
YTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVV
EKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQ
PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTV
ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF
TIDIPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDCMRGDSGRYFLTLENT
AGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDDGGTEITNYIVEKRESGT
TAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIVAEHPFVPPSAPT
RPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGL
VEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPVYD
GGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVI
SKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGD
KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCG
KLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLI
KNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEAGTGKEHIIIQWTKPES
DGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE
PSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDT
DQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD
LELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVD
KVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDG
GAPVHNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCET
SDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVV
TLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTVQDLRVLPTIDLSTMPQ
KTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRD
TGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLS
GYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIEC
RSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP
VTMTRYRSTGLIEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTT
RTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRF
RILACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPF
PICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI
GSPNSPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGT
SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSS
VSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRII
AQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGY
WVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKT
KLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDG
RTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGST
LRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLS
NVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPTDDGGSWITNYVVEKCEA
KEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKP
GAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFS
VKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA
TLVCKVTGHPKPIVKWYRQGKEIISDGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT
NQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEAVSIKIPFSGKPDPVITWQKGQ
DLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP
RGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETRYTVINLF
GKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETREVSMTKASHSSTK
ELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEISILNIARHR
NILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEALQFLHSH
NIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVS
TATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKEISIEAMDFVDRL
LVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISC
GGAIRSQRGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFG
IRQLENSEKYEITYEDGVAILYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVY
DYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYK
SGQKIKPGDDDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH
PPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH
EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHV
QKQIDKTLRMAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKGEFRLETEEKKEE
RKLRMPYDVPEPRKYKQTTIEEDQRIKQFVPMSDMKWYKKIRDQYEMPGKLDRVVQKRPK
RIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDLEIVRPARRRTPSPDYDFYYRPRRH
SLGDISDEELLLPVDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSP
QAHVKVEETRKDFRYSTYHIPTKAEASTSYAELRERHAQAAYRQPKQRQRIMAEKEDEEL
LRPVTTTQRLSEYKSELDYMSKEEKSRKKSRRQREVTEITEIEEEYEISKHAQRESSSSA
SRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRSTTPERTRPRSPSPVS
Download sequence
Identical sequences ENSNLEP00000007481 ENSNLEP00000007481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]