SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007534 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007534
Domain Number 1 Region: 75-170
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.43e-25
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 3-75
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-21
Family Canonical RBD 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007534
Domain Number - Region: 200-328
Classification Level Classification E-value
Superfamily Subtilisin-like 0.0568
Family Subtilases 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007534   Gene: ENSNLEG00000006203   Transcript: ENSNLET00000007903
Sequence length 364
Comment pep:novel supercontig:Nleu1.0:GL397360.1:5556524:5568966:1 gene:ENSNLEG00000006203 transcript:ENSNLET00000007903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRS
GRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAAS
VYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS
TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRAR
YSAF
Download sequence
Identical sequences A0A2I2YJ16 A0A2I3HZ62 A0A2J8U045 A0A2K5MKG2 A0A2K5XQU4 A0A2K6AVT5 A0A2K6MV14 A0A2K6RMM6 F7CXZ1 G2HHL8 Q4R979 Q9BWF3
ENSMMUP00000037607 ENSMMUP00000037608 ENSP00000309166 ENSP00000386561 ENSP00000386894 ENSGGOP00000014093 ENSNLEP00000007534 NP_001233570.1.37143 NP_001270355.1.63531 NP_002887.2.87134 NP_002887.2.92137 XP_003828742.1.60992 XP_004051653.1.27298 XP_007970248.1.81039 XP_007970311.1.81039 XP_008952379.1.60992 XP_009421656.1.37143 XP_010364694.1.97406 XP_010364695.1.97406 XP_010364696.1.97406 XP_010364697.1.97406 XP_011719276.1.29376 XP_011719277.1.29376 XP_011719278.1.29376 XP_011719279.1.29376 XP_011842339.1.47321 XP_011896929.1.92194 XP_011896930.1.92194 XP_012352658.1.23891 XP_014969108.1.72884 XP_014969109.1.72884 XP_015289657.1.63531 XP_015289659.1.63531 XP_017712695.1.44346 XP_017712696.1.44346 XP_018892035.1.27298 ENSPTRP00000006779 9598.ENSPTRP00000006779 9606.ENSP00000309166 ENSGGOP00000014093 ENSP00000309166 ENSP00000386561 ENSP00000386894 ENSP00000425760 ENSP00000309166 ENSP00000425446 gi|93277122|ref|NP_002887.2| ENSPTRP00000006779 ENSNLEP00000007530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]