SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007542 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007542
Domain Number 1 Region: 1407-1501
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 208-352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000262
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 3 Region: 47-127
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000746
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 973-1120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000592
Family Spectrin repeat 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007542
Domain Number - Region: 132-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00119
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 407-541
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00528
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 699-769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0419
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 863-1009
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0532
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007542   Gene: ENSNLEG00000006205   Transcript: ENSNLET00000007911
Sequence length 1530
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:22849777:23075372:-1 gene:ENSNLEG00000006205 transcript:ENSNLET00000007911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQGSPSVALSTTTVSSVAVQAGDSKIVIAVIKCGKWVQLQLAESQPNLLEIGSSQDET
KKLLHDHELLLAKLKALEDRVWELLQEADKTAEENKDQSQVYDAMAETLGEAWAALVSML
ERRTELLRLTSEFFENALEFAIKIDQAEDFLQNTHEFESAESLKSLLQLHEHHTKELLER
SLALLNKSQQLTDFIEKFKCEGPNVNPELIQGAHSSCLKIDSLLELLQDRRRQLDKYLKQ
QWQELSQVLQICQWDQQENQVTCWFQKTIRDLQEQSLGSSLSDNEDLIRKHEELIIKAKE
WNSAVEKLKSEALRILLSKDYVEKEHLQLSHQKLSQLQEEFGQLMVERNTWLKKANEFFN
SANKAFDVLGRVEAYLKLLKSEGLSLAVLAARHEELHRKIKDCTADALQKGQTLISQVDS
CSSQVSGIHEMMGCIKGRVDHLTEQCSAHKEYALKKQQLTASVEGYLRKVEMSIQKISPV
LSNAVDVGSTLSESEKILNKYLELDMQAKETSHELEAAAKTMMEKNEFVSDEMVSLSSKA
RWLAEELNLFGQSIDYRSQVLQTYVAFLKSSEEVEMQFQSLKEFYETEIPQKEQDDGKAK
HCSDSTEKQWQLFLKKSFVTQDLGLEFLNLINMAKENEILNVKNEVYLMKNTMESQKAER
EELSLLRLAWQLKATESKPGKQQWAAFKEQLKKTSHNLKLLQEALMPVSALDLGGSLQFI
LDLRQKWNDMKPQFQQLNDEVQYIMKESEELTGKGAPVKEKSQQLKDLIHFHQKQKERIQ
DYEDILYKVVQFHQVKEELGHLIKSRVPEFIEQPKELGDAHDVQIHLRCSQEKKARVDHL
HRLALSLGVDIISSVQRPHCSNVSAKNLQQQLELLEEDSMKWRAKAEEYERTLSRSVEYC
AMRDEINELKDSFKDIKKKFNNLKFNYTKKNEKSRNLKVLKYQIQQVDMYAEKMQALKRK
MEKVSNKTSDSFLNYPSDKVNVLLEVMKDLEKHVDDFDKVVTDYKKNLDLTEHFQEVIEE
CHFWYEDASATVVRVGKYSTECKTKEAVKILHQQFNKFIAPSVPQQEERIQEATDLAQRL
YGLEEGQKYIEKIVTKHKEVLESVTELCESLTELEEKLEQGDVLKMNPNLEDFHDDYIDL
LKEPEKNKQTIFNEERNKGQAQVADLLGINGTGEERLPQDLKLSTDKEGGVQGLLLPEDM
LSGEEYECVSPDDISLPPLPGSPESPLAPSDMEVEDPVSSSLSLHISSYGVQAGTSSPGD
AQESVLPPPVAFADACNDKRETFSSHFERPYLQFKAEPPLTSGGFVEKSTALHRISAEHP
ESMMSEVHERALQQHPQAKGGLLETQEKMHADNNFTKTQDRLHASPDAFSGLRFQSGTSR
GYQRQMVPREEIKSMSAKSSMVSLADQAPNFSRLLSNVTVMEGSPVTLEVEVTGFPEPTL
TWYKKGQKLSADGHLQVLHKETRHSVFIPKVCKADAGLYVARAQNSSGALSSNVILHVTG
NCRPPITRINWITLCVVYVSVSLMYWLLTQ
Download sequence
Identical sequences XP_003253834.1.23891 ENSNLEP00000007542 ENSNLEP00000007542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]