SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007550 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007550
Domain Number 1 Region: 150-267
Classification Level Classification E-value
Superfamily C-type lectin-like 3.14e-38
Family Link domain 0.0015
Further Details:      
 
Domain Number 2 Region: 263-362
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-29
Family Link domain 0.003
Further Details:      
 
Domain Number 3 Region: 1049-1167
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-27
Family C-type lectin domain 0.00017
Further Details:      
 
Domain Number 4 Region: 1014-1055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 5 Region: 44-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000165
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007550   Gene: ENSNLEG00000006221   Transcript: ENSNLET00000007919
Sequence length 1169
Comment pep:known_by_projection supercontig:Nleu1.0:GL397382.1:4457857:4484778:1 gene:ENSNLEG00000006221 transcript:ENSNLET00000007919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATFVWALGLLMLQMLLFVAGEQGTQDIADASERGLHMQKLGSGSVRAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWHGLLSLHAYHRLL
AVATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFSRELEGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLESPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEEPLILE
EKQESQQTVSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPTPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEAGAQPPTSEAAGNQMEPPLAMAVTEMLGSGQSQSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKQWMLPHPTPVSTEANRVEAH
GEATATATAPPSPAAETKVYSLPPSSTPTGQGGEAMPTTPESPRTDFRETGETSPSRVNK
AEHSSSSLWPSANRNVAVGFVSTETATETATEPTGLRGISGSESGAFDTAESPTSGLQAT
VDEVQDPWPSVYSKGLDASSPSAPLGSPRVFLVPKVTPSLEPWVATDEGPTVNPMDSTVT
PAPSDASGIWEPGSQVFEEGESTTLSPQVALVTSIVTPLTTEQGDKVGVSAMSTLGPSSS
QPHPEPEDQVETQGTSGASAPPHQGSPLGKPAVPPGTPAAASVGESASVSSGEPTVPWDP
SSTLLPVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEAHSDPCENN
PCLHGGTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPS
YGGSLCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAERDCRRRSGHLTSVHSPEEHSFI
NSFGHENTWIGLNDRIVERDFQWTDNTGL
Download sequence
Identical sequences ENSNLEP00000007550 ENSNLEP00000007550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]