SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007554 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007554
Domain Number 1 Region: 162-281
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-38
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 284-366
Classification Level Classification E-value
Superfamily C-type lectin-like 4.24e-24
Family Link domain 0.0038
Further Details:      
 
Domain Number 3 Region: 48-161
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000245
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007554   Gene: ENSNLEG00000006225   Transcript: ENSNLET00000007923
Sequence length 402
Comment pep:known_by_projection supercontig:Nleu1.0:GL397382.1:4498795:4502549:-1 gene:ENSNLEG00000006225 transcript:ENSNLET00000007923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHR
GGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQG
DGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAE
AQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAG
GGGDANGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAV
AKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFG
VYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLRV
Download sequence
Identical sequences ENSNLEP00000007554 ENSNLEP00000007554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]