SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007586 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007586
Domain Number 1 Region: 26-121
Classification Level Classification E-value
Superfamily Immunoglobulin 2.47e-23
Family I set domains 0.0072
Further Details:      
 
Domain Number 2 Region: 123-219
Classification Level Classification E-value
Superfamily Immunoglobulin 6.99e-17
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007586   Gene: ENSNLEG00000006244   Transcript: ENSNLET00000007955
Sequence length 271
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:36860927:36874973:-1 gene:ENSNLEG00000006244 transcript:ENSNLET00000007955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPKLLSLLCFRLCVGQGDTGGDGSLPKPSLSAWPSSVVPANSNVTLRCWTPARGVSFVL
RKGGIILESPKPLDSTEGAAKFHLNNLKVRNAGEYTCEYYRKASPHILSQHSDALLLLVT
GHLSKPFLQTYQRGTVTAGGRVTLQCQKRDQLFVPIMFALLKAGTSSPIQLRSPEGKEID
FSGVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEMLVTVPPGTTSSNYTLSNFIQLGLA
AIIVVIMGAFLMEAWYSRKLSPGGSEAFKPE
Download sequence
Identical sequences ENSNLEP00000007586 ENSNLEP00000007586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]